PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc07029.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 492aa    MW: 53173.9 Da    PI: 7.5468
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc07029.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding569.4e-181461148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +grWT+eEde l++++k++G g+W++ +++ g+ R++k+c++rw +yl
  Zmw_sc07029.1.g00020.1.am.mk 14 KGRWTKEEDEVLAKYIKEHGEGSWRSLPKKAGLLRCGKSCRLRWINYL 61
                                  79******************************99************97 PP

2Myb_DNA-binding31.15.3e-102522811848
                                   HTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  18 qlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   q  + +W++Ia +++ gRt++++k++w+++l
  Zmw_sc07029.1.g00020.1.am.mk 252 QIDTCQWSLIAGHLP-GRTDNEIKNHWNSHL 281
                                   334449*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-22564IPR009057Homeodomain-like
PROSITE profilePS5129422.81965IPR017930Myb domain
SMARTSM007177.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
SuperFamilySSF466892.8E-211590IPR009057Homeodomain-like
CDDcd001672.04E-111661No hitNo description
PROSITE profilePS500904.14762115IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.2E-76590IPR009057Homeodomain-like
SMARTSM007171.5E-866283IPR001005SANT/Myb domain
SuperFamilySSF466891.08E-7247283IPR009057Homeodomain-like
CDDcd001672.50E-6250281No hitNo description
PfamPF002491.9E-7255281IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-12257281IPR009057Homeodomain-like
PROSITE profilePS500906.539257281IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTKE EDEVLAKYIK EHGEGSWRSL PKKAGLLRCG KSCRLRWINY  60
LRADLKRGNI SEEEEEMILK LHATLGNRYA LRHLSLKLRL GRRPGVTRAR SLSSIDVAGS  120
SAAGYCPATA GGGRQRAREV KGDGRCTAPS ASGIALLGSR ALKRHTPGTR RAAAGVQTPN  180
EAPSLVDHCT WRYGVPGLQE HMGSLSLTAP CMLGSCWGAL RVPSSFFHVR GVLRVIVSFL  240
DLGTGLHTTC RQIDTCQWSL IAGHLPGRTD NEIKNHWNSH LSGRASDFRL GGNGQAAGRG  300
KRRGGRTSRG GNATAAKGKE KEKTAEVMLL HEVKKGQEKD TDAPTPSYQP RHDQSEEHAS  360
ASGVTSDGLE SDGPLGLTEE MVSAPLGHAS PKLEMGPDGA CVDHKIGLCM DSDDWPRVQS  420
GSGPDGLPSG DVAQELGDNK ALEDWDLTEL DLAVDHDAWD SLAWDYDEMV DVVPQGGQQG  480
ELVPDLFFLD NM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-131290582B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105092.16e-51R2R3 Myb transcription factor MYB-IF35
TrEMBLA0A0A9IUA46e-58A0A0A9IUA4_ARUDO; MYB-IF35
STRINGGRMZM2G051256_P012e-50(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3340834